(714)420-9009

Free Shipping on Orders $300+

HCG 10mg

Original price was: $99.00.Current price is: $79.00.

Product DescriptionTesamorelin is a synthetic peptide supplied in purified form for laboratory research applications. This material is produced using solid-phase peptide synthesis and is subjected to analytical testing to verify peptide identity and purity. Amino Acid SequenceTyr–Ala–Asp–Ala–Ile–Phe–Thr–Asn–Ser–Tyr–Arg–Lys–Val–Leu–Gly–Gln–Leu–Ser–Ala–Arg–Lys–Leu–Leu–Gln–Asp–Ile–Met–Ser–Arg–Gln–Gln–Gly–Glu–Ser–Asn–Gln–Glu–Arg–Gly–Ala–Arg–Ala–Arg–Leu One-letter code:YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Chemical Information Peptide Length: 44 amino acids Approx. Molecular Weight: ~5,135 g/mol Form: Lyophilized powder Purity:…

Category:

Description

HCG 10mg